Busca 7 - 37 - Glucagon - Like Peptid Human 106612 - 94 - 6, GLP-1 De Alta Pureza Humana 7-37 CAS 106612-94-6, Materia Prima Farmacéutica Acetato GLP-1 en el directorio Industry, Reliable fabricante / proveedor / fábrica de China

Buzón de Consultas (0)
Home > Lista de Producto > Péptidos de la hormona de crecimiento humano > Pérdida de Hormona de Crecimiento Humano de Alta Pureza 98% GLP-1 CAS 106612-94-6

Pérdida de Hormona de Crecimiento Humano de Alta Pureza 98% GLP-1 CAS 106612-94-6

Pérdida de Hormona de Crecimiento Humano de Alta Pureza 98% GLP-1 CAS 106612-94-6

    Tipo de Pago: T/T
    Terms of Trade: CIF
    Cantidad de pedido mínima: 1 Kilogram
    Plazo de entrega: 15 días
    Paquete: SEGÚN SEA NECESARIO
    productividad: KGS
    Marca: VOLSENCHEM
    transporte: Air
    Lugar de origen: CHINA
    Capacidad de suministro: TRUE MANUFACTURER
    Certificados : GMP Peptide

Información básica

Modelo: 106612-94-6

Descripción del producto

Ofrecemos gran calidad y alta pureza GLP-1 CAS 106612-94-6. Glucagon como el péptido -1 (GLP-1) es un secreto intestinal del intestino secreción de las células endocrinas ileales, en la actualidad principalmente como un objetivo para la diabetes tipo 2 acción del fármaco. La ventaja de GLP-1 CAS 106612-94-6 puede reducir la inhibición del vaciamiento gástrico, peristalsis intestinal. Esto proporciona una muy buena perspectiva para el tratamiento de la diabetes mellitus tipo 2. Pero debido a GLP-1 es un polipéptido, no se puede administrar por vía oral es una deficiencia importante. Somos hábiles para producir GLP-1 de alta pureza. Podemos proporcionar diverso empaquetado para satisfacer el requisito de clientes.


Thera. Goría gato: péptido Farmacéutica

Cas. No: 106612-94-6

Sinónimos: proglucagón (78-108) (humano, bovino, Guinea cerdo, ratón, rata); Preproglucagón 78-108 HUMANA; Preproglucagón (98-128) (humano, bovino, Guinea cerdo, ratón, rata); Insulinotropina (humano, bovino, Guinea cerdo, ratón, rata); GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR-LEU-GLU-GLY-GLN-ALA-ALA-LYS-GLU-PHE-ILE-ALA-TRP- LEU-VAL-LYS-GLY-ARG-Gly; GLU-GLY-GLN-ALA-LYS-GLU-PHE-ILE-ALA-H-HIS-AL-GLU-GLY-THR-PHE-THR-SER-ASP-VAL-SER-SER-TYR- TRP-LEU-VAL-LYS-GLY-ARG-GLY-OH; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG; GLP - 1 (HUMANO, 7 - 37) (BOVINO, CANINO, RATA, CERDO DE GUINEA)

106612-94-6

Fórmula molecular: C151H228N40O47

Peso molecular: 3355,67

Pureza: ≥98%

Embalaje: embalaje de exportación digna

Hoja de Seguridad: Disponible a pedido

Uso: utilizado como hormona paracrina implicada en la inhibición del glucagón

Taizhou Volsen Chemical Co., Ltd.

 

Taizhou Volsen Chemical Co., Ltd. es profesional en I + D, producción y comercialización de materias primas farmacéuticas , productos farmacéuticos intermedios en China. VOLSEN consta de unos 100 empleados con experiencia, incluidos 3 doctorados y 10 maestros, y 35,000 metros cuadrados de instalaciones que incluyen laboratorios de investigación, kilo lab, planta piloto y planta de fabricación completa,


Los especialistas en I + D de VOLSEN, el gerente de calidad y las ventas con abundante experiencia aseguran que los productos sean confiables y que el servicio sea profesional. La persona productora inspecciona cada paso de todo el proceso y verifica la calidad estrictamente, a fin de asegurar que cada lote de materia prima cumpla con el estándar de EP, CP, JP, BP, etc. Cumpliendo con los requisitos diversificados de las empresas, VOLSEN marcha constantemente para alcanzar los picos.


Volsen posee un departamento profesional de síntesis personalizada, con más de 15 investigaciones científicas de alto nivel. personal químico que tienen un título de posgrado o superior . También tenemos un sistema de gestión científica independiente. Nuestra empresa es integrat años de experiencia en producción y reservas de talento que forman una fuerte capacidad de producción de I + D , además podríamos emprender Diversas personalizaciones de productos químicos desde kg hasta tonelada, dependiendo de la base de producción y el equipo existentes.


La Unidad de fabricación está equipada con una instalación de reeducación progresiva de emisiones, efluentes y descarga de material de desecho que se sabe que tienen un impacto negativo en el medio ambiente. Además, el laboratorio y la planta están equipados con la última maquinaria, equipos, personal técnico y medios de comunicación.

Debido al suministro de calidad confiable , seguimiento eficiente, entrega programada y pronta respuesta a cualquier asunto, la compañía obtiene buenos comentarios de los clientes.

Estamos encaminados a entregar valor de negocio real a nuestros clientes. Para cualquier interés, por favor llámenos o envíenos un correo electrónico para obtener nuestros mejores servicios.

Información de Empresa

  • Nombre de empresa: Taizhou Volsen Chemical Co., Ltd.
  • Representante: Mr Chen
  • Producto / Servicio: Favipiravir Intermedios , Arbidol intermedios , Relugolix intermedios , Intermedios de Vilanterol , Remdesivir intermedios , Bromuro de umeclidinio
  • Capital (Million US $): 60000000RMB
  • Año de fundación: 2002
  • Facturación Annual: Above US$100 Million
  • Porcentaje de exportación: 91% - 100%
  • Volumen Total de Compras anual (Millones de dólares EE.UU.): Below US$1 Million
  • Número de Líneas de Producción: 5
  • Número de empleados para investigación y desarrollo: 91 -100 People
  • Número de empleados para control de calidad: 11 -20 People
  • Servicio del OEM proporcionado: yes
  • Tamaño de la fábrica (metros cuadrados): 30,000-50,000 square meters
  • Ubicación de la fábrica: Dongying Economic Development Zone , Dongying, Shandong,China
  • Persona de Contacto: Ms. Amy Cheng
  • Número de Teléfono: 86-576-88869393
Enviar a esta empresa
  • *Tema:
  • a:

  • *Mensajes:
    Su mensaje debe ser entre 20 a 8.000 caracteres